Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC11 Peptide - N-terminal region

TRAPPC11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GRY, FOIGR, LGMD2S, C4orf41

UniProt

Q7Z392

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_068761.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KGILKTGWMNKHLNLVPALVVVFYELDWDEPQWKEKQSECATRVEIVRQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
TRV-0001222-01 10 µg

Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details
Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
TRV-0001222-02 50 µg

Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details
Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
TRV-0001222-03 100 µg

Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details
Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
TRV-0001222-04 200 µg

Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details
Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
TRV-0001222-05 500 µg

Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details
Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)
TRV-0001222-06 1 mg

Active Colony Stimulating Factor 2, Granulocyte Macrophage (GM-CSF)

Sign In for Pricing
View Details