Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAPPC11 Peptide - N-terminal region

TRAPPC11 Peptide - N-terminal region

Product Specifications

Product Name Alternative

GRY, FOIGR, LGMD2S, C4orf41

UniProt

Q7Z392

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_068761.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KGILKTGWMNKHLNLVPALVVVFYELDWDEPQWKEKQSECATRVEIVRQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 650)
MBS6226190-01 0.1 mL

HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 650)

Sign In for Pricing
View Details
HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 650)
MBS6226190-02 5x 0.1 mL

HOXD11 (Homeobox D11, Hox-4.6, mouse, Homolog of, Homeo box 4F, Homeo box D11, Homeobox Protein Hox-D11, HOX4, HOX4F) (MaxLight 650)

Sign In for Pricing
View Details
SLC12A7 Protein Vector (Rat) (pPM-C-His)
PV305221 500 ng

SLC12A7 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
PRKAR1B Rabbit Polyclonal Antibody
TA380348 100 µL

PRKAR1B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zebrafish CASK Rabbit Polyclonal Antibody
orb2805488 100 µg

Zebrafish CASK Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human Vimentin ELISA Kit
EK2615 Inquire

Human Vimentin ELISA Kit

Sign In for Pricing
View Details