Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG5 Peptide - middle region

ALG5 Peptide - middle region

Product Specifications

Product Name Alternative

BA421P11.2

UniProt

Q9Y673

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135836.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOK shRNA Plasmid (h)
sc-75685-SH 20 µg

LOK shRNA Plasmid (h)

Sign In for Pricing
View Details
PIK3R5 sgRNA CRISPR Lentivector (Human) (Target 3)
K1650904 1.0 µg DNA

PIK3R5 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
GSK269962A HCl
C12873-01 5 mg

GSK269962A HCl

Sign In for Pricing
View Details
GSK269962A HCl
C12873-02 10 mM / 1 mL

GSK269962A HCl

Sign In for Pricing
View Details
GSK269962A HCl
C12873-03 25 mg

GSK269962A HCl

Sign In for Pricing
View Details
CLCN6 antibody
70R-36523 0.1 mg

CLCN6 antibody

Sign In for Pricing
View Details