Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG5 Peptide - middle region

ALG5 Peptide - middle region

Product Specifications

Product Name Alternative

BA421P11.2

UniProt

Q9Y673

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001135836.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CAPRIN1 3'UTR GFP Stable Cell Line
TU053465 1.0 mL

CAPRIN1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
GAGE13 Recombinant Protein (Human)
RP059922 100 µg

GAGE13 Recombinant Protein (Human)

Sign In for Pricing
View Details
ZNF831 Human Pre-designed siRNA Set A
HY-RS16178 1 Set

ZNF831 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
KLF6 Antibody
43742 100 µL

KLF6 Antibody

Sign In for Pricing
View Details
Vmac ORF Vector (Mouse) (pORF)
49517014 1.0 µg DNA

Vmac ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
(± ) -BI-D 10mg
A16024-10 10 mg

(± ) -BI-D 10mg

Sign In for Pricing
View Details