Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CADM3 Peptide - C-terminal region

CADM3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BIgR, NECL1, TSLL1, IGSF4B, Necl-1, synCAM3

UniProt

Q8N126

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001120645.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIFLGHYLIRHKGTYLTHEAKGSDDAPDADTAIINAEGGQSGGDDKKEYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DGKA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8G5]
TA504155BM 100 µL

DGKA Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8G5]

Sign In for Pricing
View Details
Human MMP-10 Antibody Pair Set
E-KAB-0433 50 µL & 100 µg

Human MMP-10 Antibody Pair Set

Sign In for Pricing
View Details
Neuropilin 1 (NRP1) Human Gene Knockout Kit (CRISPR)
KN202952BN 1 Kit

Neuropilin 1 (NRP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS628152 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
1,2-Diaminonaphthalene
TRC-D416400-1G 1 g

1,2-Diaminonaphthalene

Sign In for Pricing
View Details
S adenosylhomocysteine hydrolase (AHCY) (C-term) Rabbit Polyclonal Antibody
AP12360PU-N 400 µL

S adenosylhomocysteine hydrolase (AHCY) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details