What is the catalog number for CEP70 Peptide - middle region?

The catalog number for CEP70 Peptide - middle region is orb1999795.

What sizes are available for CEP70 Peptide - middle region?

CEP70 Peptide - middle region is available in the following size(s): 100 µg.

Is CEP70 Peptide - middle region in stock?

CEP70 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

CEP70 Peptide - middle region

Product Specifications

Product Name Alternative

BITE

UniProt

Q8NHQ1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001275893.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QTLQAIVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTR15380528 1 Vial

Lentiviral human CD72 sgRNA gene knockout kit - Lentiviral human CD72 sgRNA gene knockout kit (plasmid)

Sign In for Pricing

View Details

MBS6169980-01 0.1 mL

ALYREF (Aly/REF export Factor, ALY, ALY/REF, BEF, REF, THOC4) (APC)

Sign In for Pricing

View Details

MBS6169980-02 5x 0.1 mL

ALYREF (Aly/REF export Factor, ALY, ALY/REF, BEF, REF, THOC4) (APC)

Sign In for Pricing

View Details

VAng-Lsx0508-100g 100 µg

Recombinant SIV-1 Nef Protein (Mac239) [His]

Sign In for Pricing

View Details

abx313631-01 20 µg

Multiple Epidermal Growth Factor-Like Domains Protein 10 (MEGF10) Antibody (HRP)

Sign In for Pricing

View Details

abx313631-02 50 µg

Multiple Epidermal Growth Factor-Like Domains Protein 10 (MEGF10) Antibody (HRP)

Sign In for Pricing

View Details