CEP70 Peptide - middle region
CEP70 Peptide - middle region
Product Specifications
Product Name Alternative
BITE
UniProt
Q8NHQ1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001275893.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QTLQAIVSHFQKLFDVPSLNGVYPRMNEVYTRLGEMNNAVRNLQELLELD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS948127-01 0.02 mg (E-Coli)
Recombinant Mouse Lymphotoxin-alpha (Lta)
Sign In for Pricing
View Details MBS948127-02 0.1 mg (E-Coli)
Recombinant Mouse Lymphotoxin-alpha (Lta)
Sign In for Pricing
View Details MBS948127-03 1 mg (E-Coli)
Recombinant Mouse Lymphotoxin-alpha (Lta)
Sign In for Pricing
View Details MBS948127-04 5x 1 mg (E-Coli)
Recombinant Mouse Lymphotoxin-alpha (Lta)
Sign In for Pricing
View Details GTR15275139 1 Vial
Lentiviral mouse Fos shRNA (UAS) - Lentiviral mouse Fos shRNA (UAS, iRFP) (100)
Sign In for Pricing
View Details