Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNA2 Peptide - middle region

EFNA2 Peptide - middle region

Product Specifications

Product Name Alternative

ELF-1, EPLG6, LERK6, HEK7-L, LERK-6

UniProt

O43921

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001396.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NRSNPRFHAGAGDDGGGYTVEVSINDYLDIYCPHYGAPLPPAERMEHYVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TentaGel® MB FMP
MB300160.25G 25 g

TentaGel® MB FMP

Sign In for Pricing
View Details
Rabbit anti-Caenorhabditis elegans B0228.1 Polyclonal Antibody
MBS9018111 Inquire

Rabbit anti-Caenorhabditis elegans B0228.1 Polyclonal Antibody

Sign In for Pricing
View Details
Human, Rat, Mouse Lysozyme antibody
P0372 100ul

Human, Rat, Mouse Lysozyme antibody

Sign In for Pricing
View Details
Lentiviral human MMUT shRNA (UAS) - Lentiviral human MMUT shRNA (UAS, GFP) (25)
GTR15345131 1 Vial

Lentiviral human MMUT shRNA (UAS) - Lentiviral human MMUT shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Ezrin (Ab-353) Conjugated Antibody
MBS9438698-01 0.1 mL (Biotin)

Ezrin (Ab-353) Conjugated Antibody

Sign In for Pricing
View Details
Ezrin (Ab-353) Conjugated Antibody
MBS9438698-02 0.1 mL (AF350)

Ezrin (Ab-353) Conjugated Antibody

Sign In for Pricing
View Details