What is the catalog number for MCCC2 Peptide - C-terminal region?

The catalog number for MCCC2 Peptide - C-terminal region is orb1999792.

What sizes are available for MCCC2 Peptide - C-terminal region?

MCCC2 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is MCCC2 Peptide - C-terminal region in stock?

MCCC2 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

MCCC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MCCB

UniProt

Q9HCC0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_071415.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDC53521-01 50 mg

[3-Methyl-1- (methylamino) cyclopentyl]methanol

Sign In for Pricing

View Details

PDC53521-02 0.5 g

[3-Methyl-1- (methylamino) cyclopentyl]methanol

Sign In for Pricing

View Details

47059061 1.0 µg DNA

TMEM5 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing

View Details

K4270704 1.0 µg DNA

Olfr678 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing

View Details

abx653209-01 10 µg

Human Doublecortin (DCX) Protein

Sign In for Pricing

View Details

abx653209-02 50 µg

Human Doublecortin (DCX) Protein

Sign In for Pricing

View Details