MCCC2 Peptide - C-terminal region
MCCC2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
MCCB
UniProt
Q9HCC0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_071415.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRLVLGLSF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb334860-01 30 µL
Hepatitis B Virus Surface Antigen Goat Polyclonal Antibody (FITC)
Sign In for Pricing
View Details orb334860-02 50 μL
Hepatitis B Virus Surface Antigen Goat Polyclonal Antibody (FITC)
Sign In for Pricing
View Details orb334860-03 100 µL
Hepatitis B Virus Surface Antigen Goat Polyclonal Antibody (FITC)
Sign In for Pricing
View Details orb334860-04 200 µL
Hepatitis B Virus Surface Antigen Goat Polyclonal Antibody (FITC)
Sign In for Pricing
View Details 
OR72708 1 Each
(3S,4R,5R,6S) -6- (Hydroxymethyl) tetrahydro-2H-pyran-2,3,4,5-tetraol
Sign In for Pricing
View Details