Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPFFR1 Peptide - N-terminal region

NPFFR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NPFF1, GPR147, NPFF1R1, OT7T022

UniProt

Q9GZQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_071429.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Thyroid gland
CS808682 5x 5 µm

Tissue FFPE Sections, Thyroid gland

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133M1-02 100 Tests

Elab Fluor® 700 Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD274/PD-L1 Antibody[29E.2A3]
E-AB-F1133M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Human CD274/PD-L1 Antibody[29E.2A3]

Sign In for Pricing
View Details
Porcine Alpha-2-Heremans Schmid Glycoprotein (aHSG) ELISA Kit
RDR-aHSG-p-01 96 Tests

Porcine Alpha-2-Heremans Schmid Glycoprotein (aHSG) ELISA Kit

Sign In for Pricing
View Details
Porcine Alpha-2-Heremans Schmid Glycoprotein (aHSG) ELISA Kit
RDR-aHSG-p-02 48 Tests

Porcine Alpha-2-Heremans Schmid Glycoprotein (aHSG) ELISA Kit

Sign In for Pricing
View Details