Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NPFFR1 Peptide - N-terminal region

NPFFR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NPFF1, GPR147, NPFF1R1, OT7T022

UniProt

Q9GZQ6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_071429.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPSQPPNSSWPLSQNGTNTEATPATNLTFSSYYQHTSPVAAMFIVAYALI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-(-)-3-Hydroxypyrrolidine Hydrochloride
TRC-H953050-25G 25 g

(R)-(-)-3-Hydroxypyrrolidine Hydrochloride

Sign In for Pricing
View Details
Gap43 (C-term) Chicken Polyclonal Antibody
AP26435SU-N 100 µL

Gap43 (C-term) Chicken Polyclonal Antibody

Sign In for Pricing
View Details
Spsb1 Mouse Gene Knockout Kit (CRISPR)
KN516675 1 Kit

Spsb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rpusd4 Mouse Gene Knockout Kit (CRISPR)
KN515126 1 Kit

Rpusd4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPTP mu (PTPRM) Human Gene Knockout Kit (CRISPR)
KN219912RB 1 Kit

RPTP mu (PTPRM) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3081), CF640R conjugate, 0.1mg/mL
BNC403081-100 1x 100 µL

Uroplakin 1B (Urothelial Differentiation Marker) (UPK1B/3081), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details