LDAH Peptide - middle region
LDAH Peptide - middle region
Product Specifications
Product Name Alternative
HLDAH, C2orf43
UniProt
Q9H6V9
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_068744.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
18062111 3x 1.0 µg
DFNA37 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
abx176325-01 100 µL
Eukaryotic Translation Elongation Factor 1 Epsilon 1 (EEF1E1) Antibody
Sign In for Pricing
View Details abx176325-02 200 µL
Eukaryotic Translation Elongation Factor 1 Epsilon 1 (EEF1E1) Antibody
Sign In for Pricing
View Details abx176325-03 1 mL
Eukaryotic Translation Elongation Factor 1 Epsilon 1 (EEF1E1) Antibody
Sign In for Pricing
View Details 