What is the catalog number for LDAH Peptide - middle region?

The catalog number for LDAH Peptide - middle region is orb1999782.

What sizes are available for LDAH Peptide - middle region?

LDAH Peptide - middle region is available in the following size(s): 100 µg.

Is LDAH Peptide - middle region in stock?

LDAH Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

LDAH Peptide - middle region

Product Specifications

Product Name Alternative

HLDAH, C2orf43

UniProt

Q9H6V9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_068744.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SYFTLQMLKRVPELPVIRAFLLFPTIERMSESPNGRIATPLLCWFRYVLY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

K6111202 1.0 µg DNA

Chchd1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing

View Details

BSKH60095-01 48 Tests

Human Transferrin (TRF) ELISA Kit

Sign In for Pricing

View Details

BSKH60095-02 96 Tests

Human Transferrin (TRF) ELISA Kit

Sign In for Pricing

View Details

orb1669364-01 48 Tests

Mouse Early growth response protein 1 (EGR1) ELISA Kit

Sign In for Pricing

View Details

orb1669364-02 96 Tests

Mouse Early growth response protein 1 (EGR1) ELISA Kit

Sign In for Pricing

View Details

NBP2-90604F 0.1 mL

Rabbit Monoclonal IGSF4B/SynCAM3/CADM3 Antibody (024) [FITC]

Sign In for Pricing

View Details