CPNE3 Peptide - middle region
CPNE3 Peptide - middle region
Product Specifications
Product Name Alternative
CPN3, PRO1071
UniProt
O75131
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003900.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EEIKDNRVVLFEMEARKLDNKDLFGKSDPYLEFHKQTSDGNWLMVHRTEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K3439105 3x 1.0 µg
Coq10b sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
Sign In for Pricing
View Details 
245040-AP 100 µL
CTBP1 (C-terminal Binding Protein 1, BARS, MGC104684) (AP) discontinued
Sign In for Pricing
View Details bsm-62543R-BF680-TR 20 µL
ADH4 Recombinant Antibody, AbBy Fluor™ 680 Conjugated
Sign In for Pricing
View Details 
bs-18284R-Cy5.5 100 µL
LINGO2 Polyclonal Antibody, Cy5.5 Conjugated
Sign In for Pricing
View Details