CPNE3 Peptide - middle region
CPNE3 Peptide - middle region
Product Specifications
Product Name Alternative
CPN3, PRO1071
UniProt
O75131
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_003900.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EEIKDNRVVLFEMEARKLDNKDLFGKSDPYLEFHKQTSDGNWLMVHRTEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
22436151 3x 1.0 µg DNA
GPAT2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
Sign In for Pricing
View Details 
TL304342V 500 µL Each
GIPC (GIPC2) Human shRNA Lentiviral Particle (Locus ID 54810)
Sign In for Pricing
View Details OR1073369-01 25 mg
(S) -2- ((S) -2- (5- (2,5-Dioxo-2,5-dihydro-1H-pyrrol-1-yl) pentanamido) -3-methylbutanamido) -N- (4- (hydroxymethyl) phenyl) -5-ureidopentanamide
Sign In for Pricing
View Details OR1073369-02 50 mg
(S) -2- ((S) -2- (5- (2,5-Dioxo-2,5-dihydro-1H-pyrrol-1-yl) pentanamido) -3-methylbutanamido) -N- (4- (hydroxymethyl) phenyl) -5-ureidopentanamide
Sign In for Pricing
View Details OR1073369-03 100 mg
(S) -2- ((S) -2- (5- (2,5-Dioxo-2,5-dihydro-1H-pyrrol-1-yl) pentanamido) -3-methylbutanamido) -N- (4- (hydroxymethyl) phenyl) -5-ureidopentanamide
Sign In for Pricing
View Details