Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR8 Peptide - middle region

ACTR8 Peptide - middle region

Product Specifications

Product Name Alternative

ARP8, hArp8, INO80N

UniProt

Q9H981

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075050.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLQHRSQGDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MED8 (Center) Rabbit Polyclonal Antibody
AP52660PU-N 400 µL

MED8 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LXR beta (NR1H2) Rabbit Polyclonal Antibody
TA379283 100 µL

LXR beta (NR1H2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(Fmoc-Cys-OSu)2
TRC-F657730-500MG 500 mg

(Fmoc-Cys-OSu)2

Sign In for Pricing
View Details
Telapristone Acetate
TRC-T291665-1MG 1 mg

Telapristone Acetate

Sign In for Pricing
View Details
PLP1 Chicken Polyclonal Antibody
AP31819PU-N 100 µg

PLP1 Chicken Polyclonal Antibody

Sign In for Pricing
View Details
Human SIRPB2 activation kit by CRISPRa
GA117179 1 Kit

Human SIRPB2 activation kit by CRISPRa

Sign In for Pricing
View Details