Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTR8 Peptide - middle region

ACTR8 Peptide - middle region

Product Specifications

Product Name Alternative

ARP8, hArp8, INO80N

UniProt

Q9H981

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_075050.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLQHRSQGDPEDPHDEHYLLATQSKQEQSAKATADRKSASKPIGFEGDLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZKSCAN1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]
CF810966 100 µg

ZKSCAN1 Mouse Monoclonal Antibody [Clone ID: OTI2C9]

Sign In for Pricing
View Details
Human TCIM activation kit by CRISPRa
GA111245 1 Kit

Human TCIM activation kit by CRISPRa

Sign In for Pricing
View Details
Human NSRP1 activation kit by CRISPRa
GA113365 1 Kit

Human NSRP1 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Bckdhb activation kit by CRISPRa
GA200379 1 Kit

Mouse Bckdhb activation kit by CRISPRa

Sign In for Pricing
View Details
2,3,4,5,6-Pentachlorobenzonitrile
TRC-P220470-5G 5 g

2,3,4,5,6-Pentachlorobenzonitrile

Sign In for Pricing
View Details
AIP Recombinant Rabbit monoclonal Antibody
HA750858 100 µL

AIP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details