Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB7 Peptide - middle region

NDUFB7 Peptide - middle region

Product Specifications

Product Name Alternative

B18, CI-B18

UniProt

P17568

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004137.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Fluoroadenosine
TRC-F587218-500MG 500 mg

2-Fluoroadenosine

Sign In for Pricing
View Details
Hydroxy Tyrosol (>85%)
TRC-H977000-5G 5 g

Hydroxy Tyrosol (>85%)

Sign In for Pricing
View Details
Aprataxin (APTX) (NM_001195251) Human Over-expression Lysate
LY434136 100 µg

Aprataxin (APTX) (NM_001195251) Human Over-expression Lysate

Sign In for Pricing
View Details
StAR Recombinant Rabbit Monoclonal Antibody [JE32-23]
HA721469 100 µL

StAR Recombinant Rabbit Monoclonal Antibody [JE32-23]

Sign In for Pricing
View Details
PLK1 Recombinant Rabbit monoclonal Antibody
HA750944 100 µL

PLK1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS804103 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details