Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFB7 Peptide - middle region

NDUFB7 Peptide - middle region

Product Specifications

Product Name Alternative

B18, CI-B18

UniProt

P17568

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004137.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KCKRDSFPNFLACKQERHDWDYCEHRDYVMRMKEFERERRLLQRKKRREK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF4H (NM_031992) Human Recombinant Protein
TP304028 20 µg

EIF4H (NM_031992) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Kidney
CR561141 5 µg

Tissue Total RNA, Kidney

Sign In for Pricing
View Details
SGK1 (NM_001291995) Human Tagged ORF Clone
RG237901 10 µg

SGK1 (NM_001291995) Human Tagged ORF Clone

Sign In for Pricing
View Details
Tmem47 (NM_138751) Mouse Tagged ORF Clone
MG201624 10 µg

Tmem47 (NM_138751) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
SSB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C8]
TA500426BM 100 µL

SSB Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2C8]

Sign In for Pricing
View Details
Sodium Naphthalene-2,6-disulfonate
TRC-S646010-5G 5 g

Sodium Naphthalene-2,6-disulfonate

Sign In for Pricing
View Details