GPRC5C Peptide - middle region
GPRC5C Peptide - middle region
Product Specifications
Product Name Alternative
RAIG3, RAIG-3
UniProt
Q9NQ84
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_061123.3
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FYVIPEVSQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GTR15127578 1 Vial
Lentiviral mouse Mapkbp1 shRNA (UAS) - Lentiviral mouse Mapkbp1 shRNA (UAS) (100)
Sign In for Pricing
View Details MBS6277250-01 0.2 mL
B7H6, CT (NCR3LG1, B7H6, Natural cytotoxicity triggering receptor 3 ligand 1, B7 homolog 6) (AP)
Sign In for Pricing
View Details MBS6277250-02 5x 0.2 mL
B7H6, CT (NCR3LG1, B7H6, Natural cytotoxicity triggering receptor 3 ligand 1, B7 homolog 6) (AP)
Sign In for Pricing
View Details 
TRC-A293985-100MG 100 mg
2-Amino-6-cyclopropylamino-9H-purine Hydrochloride Salt
Sign In for Pricing
View Details RY113127-02 100 Tests
Anti-Rat CD2/LFA-2/OX-34 Antibody (OX-34), PE
Sign In for Pricing
View Details