Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPRC5C Peptide - middle region

GPRC5C Peptide - middle region

Product Specifications

Product Name Alternative

RAIG3, RAIG-3

UniProt

Q9NQ84

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_061123.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FYVIPEVSQVTKSSPEQSYQGDMYPTRGVGYETILKEQKGQSMFVENKAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBE2L3 (C-term) Rabbit pAb
E2620712 100 µL

UBE2L3 (C-term) Rabbit pAb

Sign In for Pricing
View Details
Tas2r123-set siRNA/shRNA/RNAi Lentivector (Rat)
46160096 4x 500 ng

Tas2r123-set siRNA/shRNA/RNAi Lentivector (Rat)

Sign In for Pricing
View Details
GAGE12J (NM_001098406) Human Tagged ORF Clone
RC218555 10 µg

GAGE12J (NM_001098406) Human Tagged ORF Clone

Sign In for Pricing
View Details
MAPK4 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-4131R-PerCP-Cy5.5 100 µL

MAPK4 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details
GLE1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2525124 100 µL

GLE1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
DNA Hybridization Buffer
10750009-1 1 L

DNA Hybridization Buffer

Sign In for Pricing
View Details