Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIMT1 Peptide - middle region

DIMT1 Peptide - middle region

Product Specifications

Product Name Alternative

DIM1, DIMT1L, HUSSY5, HSA9761

UniProt

Q9UNQ2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055288.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDKN2AIPNL Antibody, HRP conjugated
A16878-50UG 50 µg

CDKN2AIPNL Antibody, HRP conjugated

Sign In for Pricing
View Details
RNase L Recombinant Antibody, APC Conjugated
bsm-62078R-APC 100 µL

RNase L Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal COX5b Antibody [CoraFluor 1]
NBP2-97091CL1 0.1 mL

Rabbit Polyclonal COX5b Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Fam196a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4314106 1.0 µg DNA

Fam196a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
PRKAG2 Rabbit Polyclonal Antibody
orb1339-01 50 μL

PRKAG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PRKAG2 Rabbit Polyclonal Antibody
orb1339-02 100 µL

PRKAG2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details