Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACTIN Peptide - C-terminal region

CACTIN Peptide - C-terminal region

Product Specifications

Product Name Alternative

FSAPc, C19orf29, NY-REN-24

UniProt

Q8WUQ7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074012.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse PMF1 shRNA Plasmid
abx975933-01 150 µg

Mouse PMF1 shRNA Plasmid

Sign In for Pricing
View Details
Mouse PMF1 shRNA Plasmid
abx975933-02 300 µg

Mouse PMF1 shRNA Plasmid

Sign In for Pricing
View Details
Anti-Fruit fly CG1113 Antibody (Biotine Conjugate)
DZ41287-Biotin 200 µL/Vial

Anti-Fruit fly CG1113 Antibody (Biotine Conjugate)

Sign In for Pricing
View Details
NERF (m) -PR
sc-45937-PR 10 µM - 20 µL

NERF (m) -PR

Sign In for Pricing
View Details
Recombinant Human LMNB2 Protein, N-His
orb3059021-01 50 µg

Recombinant Human LMNB2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human LMNB2 Protein, N-His
orb3059021-02 100 µg

Recombinant Human LMNB2 Protein, N-His

Sign In for Pricing
View Details