Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CACTIN Peptide - C-terminal region

CACTIN Peptide - C-terminal region

Product Specifications

Product Name Alternative

FSAPc, C19orf29, NY-REN-24

UniProt

Q8WUQ7

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001074012.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADKYRPRKPRFFNRVHTGFEWNKYNQTHYDFDNPPPKIVQGYKFNIFYPD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAAR1 siRNA (Human)
MBS8227198-01 15 nmol

TAAR1 siRNA (Human)

Sign In for Pricing
View Details
TAAR1 siRNA (Human)
MBS8227198-02 30 nmol

TAAR1 siRNA (Human)

Sign In for Pricing
View Details
TAAR1 siRNA (Human)
MBS8227198-03 5x 30 nmol

TAAR1 siRNA (Human)

Sign In for Pricing
View Details
ELISA kit for Human COL6?1 (Collagen Type ? Alpha 1)
E-EL-H0780 96 Tests

ELISA kit for Human COL6?1 (Collagen Type ? Alpha 1)

Sign In for Pricing
View Details
GSDMD Mouse Monoclonal Antibody (Cy3)
orb2600840 100 µg

GSDMD Mouse Monoclonal Antibody (Cy3)

Sign In for Pricing
View Details
Dlx5 Antibody
orb2807980 100 µL

Dlx5 Antibody

Sign In for Pricing
View Details