Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RMDN1 Peptide - C-terminal region

RMDN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RMD1, RMD-1, CGI-90, FAM82B

UniProt

Q96DB5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273636.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPNFYSKNLLLLGKTYLKLHNKKLAAFWLMKAKDYPAHTEEDKQIQTEAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoacylglycerol-O-acyltransferase 2 (MOGAT2) ELISA Kit
RDR-MOGAT2-Hu-01 96 Tests

Human Monoacylglycerol-O-acyltransferase 2 (MOGAT2) ELISA Kit

Sign In for Pricing
View Details
Human Monoacylglycerol-O-acyltransferase 2 (MOGAT2) ELISA Kit
RDR-MOGAT2-Hu-02 48 Tests

Human Monoacylglycerol-O-acyltransferase 2 (MOGAT2) ELISA Kit

Sign In for Pricing
View Details
1,4-Bis(2-hydroxyethyl) 2,5-dihydroxy-1,4-benzenedicarboxylate-d8
TRC-B280591-50MG 50 mg

1,4-Bis(2-hydroxyethyl) 2,5-dihydroxy-1,4-benzenedicarboxylate-d8

Sign In for Pricing
View Details
CD9 Recombinant Monoclonal Mouse Antibody (2310.9), APC-AstralTM813 Conjugate - Biotium Choice
P015-A813-500 1x 500 µL

CD9 Recombinant Monoclonal Mouse Antibody (2310.9), APC-AstralTM813 Conjugate - Biotium Choice

Sign In for Pricing
View Details
SEC14L1 (NM_001143998) Human Over-expression Lysate
LY428458 100 µg

SEC14L1 (NM_001143998) Human Over-expression Lysate

Sign In for Pricing
View Details
Echinatin
TRC-E378505-50MG 50 mg

Echinatin

Sign In for Pricing
View Details