BORA Peptide - middle region
BORA Peptide - middle region
Product Specifications
Product Name Alternative
C13orf34
UniProt
Q6PGQ7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001273675.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PTFSPIEFQIGETPLSEQRKFTVHSPDASSGTNSNGITNPCIRSPYIDGC
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
038251-PE 200 µL
MBOAT4, ID (MBOAT4, GOAT, OACT4, Ghrelin O-acyltransferase, Membrane-bound O-acyltransferase domain-containing protein 4) (PE) discontinued
Sign In for Pricing
View Details 
MBS6342975-01 0.2 mL
RNF8 (RNF8, KIAA0646, E3 ubiquitin-protein ligase RNF8, RING finger protein 8) (Biotin)
Sign In for Pricing
View Details MBS6342975-02 5x 0.2 mL
RNF8 (RNF8, KIAA0646, E3 ubiquitin-protein ligase RNF8, RING finger protein 8) (Biotin)
Sign In for Pricing
View Details 
C4982-26 10 mg
7-Chloro-5- (2-fluorophenyl) -2-methylamino-3H-1,4-benzodiazepine-13C1
Sign In for Pricing
View Details