Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BORA Peptide - middle region

BORA Peptide - middle region

Product Specifications

Product Name Alternative

C13orf34

UniProt

Q6PGQ7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001273675.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTFSPIEFQIGETPLSEQRKFTVHSPDASSGTNSNGITNPCIRSPYIDGC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-P97/DAP5/EIF4G2 Antibody Picoband®, PE Conjugate
A03888-2-PE 100 µg/Vial

Anti-P97/DAP5/EIF4G2 Antibody Picoband®, PE Conjugate

Sign In for Pricing
View Details
HemE Antibody
orb813456 2 mg

HemE Antibody

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Neutrophil Specific Antigen 1 (NB1)
MBS2131995-01 0.1 mL

PE Linked Monoclonal Antibody to Neutrophil Specific Antigen 1 (NB1)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Neutrophil Specific Antigen 1 (NB1)
MBS2131995-02 0.2 mL

PE Linked Monoclonal Antibody to Neutrophil Specific Antigen 1 (NB1)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Neutrophil Specific Antigen 1 (NB1)
MBS2131995-03 0.5 mL

PE Linked Monoclonal Antibody to Neutrophil Specific Antigen 1 (NB1)

Sign In for Pricing
View Details
PE Linked Monoclonal Antibody to Neutrophil Specific Antigen 1 (NB1)
MBS2131995-04 1 mL

PE Linked Monoclonal Antibody to Neutrophil Specific Antigen 1 (NB1)

Sign In for Pricing
View Details