What is the catalog number for HK1 Peptide - middle region?

The catalog number for HK1 Peptide - middle region is orb1999770.

What sizes are available for HK1 Peptide - middle region?

HK1 Peptide - middle region is available in the following size(s): 100 µg.

Is HK1 Peptide - middle region in stock?

HK1 Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

HK1 Peptide - middle region

Product Specifications

Product Name Alternative

HKD, HKI, HXK1, HMSNR, HK1-ta, HK1-tb, HK1-tc

UniProt

P19367

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000179.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CQA5883-01 30 µL

Anti-CD170 Antibody

Sign In for Pricing

View Details

CQA5883-02 50 μL

Anti-CD170 Antibody

Sign In for Pricing

View Details

CQA5883-03 100 µL

Anti-CD170 Antibody

Sign In for Pricing

View Details

CQA5883-04 200 µL

Anti-CD170 Antibody

Sign In for Pricing

View Details

NBP3-08435DL594 100 µL

Rabbit Monoclonal LEF1 Antibody (LEF1/341R) [DyLight 594]

Sign In for Pricing

View Details

bs-5660R 100 µL

Phospho-NFKB p65 (Ser529) Polyclonal Antibody

Sign In for Pricing

View Details