Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HK1 Peptide - middle region

HK1 Peptide - middle region

Product Specifications

Product Name Alternative

HKD, HKI, HXK1, HMSNR, HK1-ta, HK1-tb, HK1-tc

UniProt

P19367

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_000179.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC5B Monoclonal Antibody
BT-MCA3536-01 50 µL

MUC5B Monoclonal Antibody

Sign In for Pricing
View Details
MUC5B Monoclonal Antibody
BT-MCA3536-02 100 µL

MUC5B Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Smegmatis rplA Protein (aa 2-235)
VAng-Yyj4791-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Smegmatis rplA Protein (aa 2-235)

Sign In for Pricing
View Details
Dram ORF Vector (Rat) (pORF)
18589016 1.0 µg DNA

Dram ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
IL-17D Rabbit Polyclonal Antibody
MBS9512615-01 0.05 mL

IL-17D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IL-17D Rabbit Polyclonal Antibody
MBS9512615-02 0.1 mL

IL-17D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details