Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BUD31 Peptide - N-terminal region

BUD31 Peptide - N-terminal region

Product Specifications

Product Name Alternative

G10, EDG2, Cwc14, EDG-2, fSAP17, YCR063W

UniProt

P41223

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003901.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AzoDye-2 Alkyne
2434-AAT 1 mg

AzoDye-2 Alkyne

Sign In for Pricing
View Details
Green Fluorescent FAM In vivo Poly (active) Caspase (VAD) Assay
981 24 Tests

Green Fluorescent FAM In vivo Poly (active) Caspase (VAD) Assay

Sign In for Pricing
View Details
CD45 / LCA (135-4C5), CF680R conjugate, 0.1mg/mL
BNC810172-500 1x 500 µL

CD45 / LCA (135-4C5), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813D-01 25 µg

PE Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
PE Mouse IgG2b, κ Isotype Control[MPC-11]
E-AB-F09813D-02 100 µg

PE Mouse IgG2b, κ Isotype Control[MPC-11]

Sign In for Pricing
View Details
3-Cyanoindole
TRC-C987993-50G 50 g

3-Cyanoindole

Sign In for Pricing
View Details