Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BUD31 Peptide - N-terminal region

BUD31 Peptide - N-terminal region

Product Specifications

Product Name Alternative

G10, EDG2, Cwc14, EDG-2, fSAP17, YCR063W

UniProt

P41223

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_003901.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADK (NM_001123) Human Over-expression Lysate
LC420110 20 µg

ADK (NM_001123) Human Over-expression Lysate

Sign In for Pricing
View Details
2,5-Dihydroxy-1,4-benzoquinone
TRC-D447105-1G 1 g

2,5-Dihydroxy-1,4-benzoquinone

Sign In for Pricing
View Details
RDH12 (NM_152443) Human Over-expression Lysate
LY403471 100 µg

RDH12 (NM_152443) Human Over-expression Lysate

Sign In for Pricing
View Details
GUCY1A1 (NM_000856) Human Recombinant Protein
TP306063M 100 µg

GUCY1A1 (NM_000856) Human Recombinant Protein

Sign In for Pricing
View Details
CTLA4 Antibody (HRP)
KH-194-01 50 μL

CTLA4 Antibody (HRP)

Sign In for Pricing
View Details
CTLA4 Antibody (HRP)
KH-194-02 100 µL

CTLA4 Antibody (HRP)

Sign In for Pricing
View Details