Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPT2 Peptide - C-terminal region

ANGPT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANG2, AGPT2

UniProt

O15123

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001112359.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CCDC171 siRNA
abx910568-01 15 nmol

Mouse CCDC171 siRNA

Sign In for Pricing
View Details
Mouse CCDC171 siRNA
abx910568-02 30 nmol

Mouse CCDC171 siRNA

Sign In for Pricing
View Details
Anti-HER-2 / c-erbB-2 / neu / CD340 Monoclonal Antibody (Clone: SPM172)
36-2224-100 100 µg

Anti-HER-2 / c-erbB-2 / neu / CD340 Monoclonal Antibody (Clone: SPM172)

Sign In for Pricing
View Details
CYP20A1, CT (Cytochrome P450 20A1, UNQ667/PRO1301) (MaxLight 750) discontinued
C8929-03D-ML750 100 µL

CYP20A1, CT (Cytochrome P450 20A1, UNQ667/PRO1301) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human DUSP15 (NM_177991) AAV Particle
RC216271A1V 250 µL

Human DUSP15 (NM_177991) AAV Particle

Sign In for Pricing
View Details
Cers4 Protein Vector (Rat) (pPB-N-His)
PV259523 500 ng

Cers4 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details