Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPT2 Peptide - C-terminal region

ANGPT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANG2, AGPT2

UniProt

O15123

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001112359.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human F2-isoprostane ELISA Kit
SL3468Hu-01 96 Tests

Human F2-isoprostane ELISA Kit

Sign In for Pricing
View Details
Human F2-isoprostane ELISA Kit
SL3468Hu-02 48 Tests

Human F2-isoprostane ELISA Kit

Sign In for Pricing
View Details
TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (PE)
MBS6186266-01 0.1 mL

TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (PE)

Sign In for Pricing
View Details
TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (PE)
MBS6186266-02 5x 0.1 mL

TCF2 (HNF1 Homeobox B, FJHN, HNF1beta, HNF2, HPC11, LF-B3, LFB3, MODY5, TCF2, VHNF1) (PE)

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase (l (1)G0196), partial
MBS1356457 Inquire

Recombinant Drosophila melanogaster Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase (l (1)G0196), partial

Sign In for Pricing
View Details
SLCO1B1 Antibody
ABD4534 100 µg

SLCO1B1 Antibody

Sign In for Pricing
View Details