Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPT2 Peptide - C-terminal region

ANGPT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANG2, AGPT2

UniProt

O15123

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001112359.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

A2M (Alpha-2-Macroglobulin) BioAssayTM ELISA Kit (Rat) discontinued
353575-01 48 Tests

A2M (Alpha-2-Macroglobulin) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
A2M (Alpha-2-Macroglobulin) BioAssayTM ELISA Kit (Rat) discontinued
353575-02 96 Tests

A2M (Alpha-2-Macroglobulin) BioAssayTM ELISA Kit (Rat) discontinued

Sign In for Pricing
View Details
EFS Antibody
E51A14748 100 µL

EFS Antibody

Sign In for Pricing
View Details
PPM1B Polyclonal Antibody, Biotin Conjugated
bs-7929R-Biotin 100 µL

PPM1B Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
TDG 293 Cell Lysate
401034 0.1 mg

TDG 293 Cell Lysate

Sign In for Pricing
View Details
EDA1 Antibody
8045-01mg 0.1 mg

EDA1 Antibody

Sign In for Pricing
View Details