Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGPT2 Peptide - C-terminal region

ANGPT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANG2, AGPT2

UniProt

O15123

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001112359.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKATTMMIRP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD267 Mouse mAb
63319 100 µL

CD267 Mouse mAb

Sign In for Pricing
View Details
SIGLEC8 (NM_014442) Human Tagged Lenti ORF Clone
RC208582L4 10 µg

SIGLEC8 (NM_014442) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-MAP2 Antibody (Monoclonal, HM2)
Ab1063 100μ/Vial

Anti-MAP2 Antibody (Monoclonal, HM2)

Sign In for Pricing
View Details
BLM siRNA (Mouse)
MBS8200007-01 15 nmol

BLM siRNA (Mouse)

Sign In for Pricing
View Details
BLM siRNA (Mouse)
MBS8200007-02 30 nmol

BLM siRNA (Mouse)

Sign In for Pricing
View Details
BLM siRNA (Mouse)
MBS8200007-03 5x 30 nmol

BLM siRNA (Mouse)

Sign In for Pricing
View Details