Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1D Peptide - middle region

CD1D Peptide - middle region

Product Specifications

Product Name Alternative

R3, CD1A, R3G1

UniProt

P15813

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001757.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ERFE Pre-designed siRNA Set A
SI005092A 1 Each

Human ERFE Pre-designed siRNA Set A

Sign In for Pricing
View Details
EIF2G Rabbit pAb, PE-Cy5.5 conjugated
orb2878045 100 µL

EIF2G Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
Fac-[Re (CO) 3 (L3) (H2O) ][NO3]
orb2277858-01 5 mg

Fac-[Re (CO) 3 (L3) (H2O) ][NO3]

Sign In for Pricing
View Details
Fac-[Re (CO) 3 (L3) (H2O) ][NO3]
orb2277858-02 50 mg

Fac-[Re (CO) 3 (L3) (H2O) ][NO3]

Sign In for Pricing
View Details
Dotinurad Impurity 68
RM-D152168-01 10 mg

Dotinurad Impurity 68

Sign In for Pricing
View Details
Dotinurad Impurity 68
RM-D152168-02 25 mg

Dotinurad Impurity 68

Sign In for Pricing
View Details