Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD1D Peptide - middle region

CD1D Peptide - middle region

Product Specifications

Product Name Alternative

R3, CD1A, R3G1

UniProt

P15813

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001757.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM-Leu-CMK Green FLISP Assay Kit
MBS258023-01 25 Tests

FAM-Leu-CMK Green FLISP Assay Kit

Sign In for Pricing
View Details
FAM-Leu-CMK Green FLISP Assay Kit
MBS258023-02 100 Tests

FAM-Leu-CMK Green FLISP Assay Kit

Sign In for Pricing
View Details
FAM-Leu-CMK Green FLISP Assay Kit
MBS258023-03 5x 100 Tests

FAM-Leu-CMK Green FLISP Assay Kit

Sign In for Pricing
View Details
MTMR2 Antibody
orb2672603-01 50 µL

MTMR2 Antibody

Sign In for Pricing
View Details
MTMR2 Antibody
orb2672603-02 100 µL

MTMR2 Antibody

Sign In for Pricing
View Details
MTMR2 Antibody
orb2672603-03 200 µL

MTMR2 Antibody

Sign In for Pricing
View Details