Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MOG Peptide - middle region

MOG Peptide - middle region

Product Specifications

Product Name Alternative

BTN6, BTNL11, MOGIG2, NRCLP7

UniProt

Q16653

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008229.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TXNDC16 activation kit by CRISPRa
GA111576 1 Kit

Human TXNDC16 activation kit by CRISPRa

Sign In for Pricing
View Details
ELOVL2 Antibody
8C15618-AAT 50 µg

ELOVL2 Antibody

Sign In for Pricing
View Details
Cimaterol (CIM) ELISA Kit
RDF-E026 96 Tests

Cimaterol (CIM) ELISA Kit

Sign In for Pricing
View Details
NRAS Human Gene Knockout Kit (CRISPR)
KN202681BN 1 Kit

NRAS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PAPP A (PAPPA) Human Gene Knockout Kit (CRISPR)
KN209767 1 Kit

PAPP A (PAPPA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PRKAR1B (N-term) Rabbit Polyclonal Antibody
AP13604PU-N 400 µL

PRKAR1B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details