LYN Peptide - N-terminal region
LYN Peptide - N-terminal region
Product Specifications
Product Name Alternative
JTK8, p53Lyn, p56Lyn
UniProt
P07948
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
NCBI Accession Number
NP_001104567.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKDPEEQGDIVVALY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9942229 Inquire
Cat DNA Damage-Regulated Autophagy Modulator Protein 2 (TMEM77) ELISA Kit
Sign In for Pricing
View Details 
100130W0-AAT 100 Tests
MFluor™ Red 780 Anti-human CD1 Antibody *L161*
Sign In for Pricing
View Details