What is the catalog number for TNFSF15 Peptide - C-terminal region?

The catalog number for TNFSF15 Peptide - C-terminal region is orb1999760.

What sizes are available for TNFSF15 Peptide - C-terminal region?

TNFSF15 Peptide - C-terminal region is available in the following size(s): 100 µg.

Is TNFSF15 Peptide - C-terminal region in stock?

TNFSF15 Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

TNFSF15 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TL1, TL1A, VEGI, TNLG1B, VEGI192A

UniProt

O95150

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001191273.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PVT74097 2 µg

PLV3-U6-GPX4-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing

View Details

385116 200 µL

AARS discontinued

Sign In for Pricing

View Details

RN210446 10 µg

Foxo3 (NM_001106395) Rat Untagged Clone

Sign In for Pricing

View Details

orb2561480-01 25 µL

BCKDH kinase Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing

View Details

orb2561480-02 50 µL

BCKDH kinase Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing

View Details

orb2561480-03 100 µL

BCKDH kinase Recombinant Rabbit Monoclonal Antibody

Sign In for Pricing

View Details