Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PICALM Peptide - middle region

PICALM Peptide - middle region

Product Specifications

Product Name Alternative

LAP, CALM, CLTH

UniProt

Q13492

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001008660.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SH2D1B Antibody
8C18698-AAT 50 µg

SH2D1B Antibody

Sign In for Pricing
View Details
GTF2H3 Mouse Monoclonal Antibody [Clone ID: OTI4B5]
CF812723 100 µg

GTF2H3 Mouse Monoclonal Antibody [Clone ID: OTI4B5]

Sign In for Pricing
View Details
Human MMP-8 (Matrix Metalloproteinase 8) CLIA Kit
E-CL-H0935-01 24 Tests

Human MMP-8 (Matrix Metalloproteinase 8) CLIA Kit

Sign In for Pricing
View Details
Human MMP-8 (Matrix Metalloproteinase 8) CLIA Kit
E-CL-H0935-02 48 Tests

Human MMP-8 (Matrix Metalloproteinase 8) CLIA Kit

Sign In for Pricing
View Details
Human MMP-8 (Matrix Metalloproteinase 8) CLIA Kit
E-CL-H0935-03 96 Tests

Human MMP-8 (Matrix Metalloproteinase 8) CLIA Kit

Sign In for Pricing
View Details
TentaGel® MB HMBA
MB250140.25G 25 g

TentaGel® MB HMBA

Sign In for Pricing
View Details