Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD226 Peptide - C-terminal region

CD226 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PTA1, DNAM1, DNAM-1, TLiSA1

UniProt

Q15762

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_006557.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLFTESWDTQKAPNNYRSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps6ka2, NT (Rps6ka2, Mapkapk1c, Rsk3, Ribosomal protein S6 kinase alpha-2, 90kD ribosomal protein S6 kinase 2, MAP kinase-activated protein kinase 1c, Protein-tyrosine kinase Mpk-9, Ribosomal S6 kinase 3, pp90RSK3) (Biotin) discontinued
041252-Biotin 200 µL

Rps6ka2, NT (Rps6ka2, Mapkapk1c, Rsk3, Ribosomal protein S6 kinase alpha-2, 90kD ribosomal protein S6 kinase 2, MAP kinase-activated protein kinase 1c, Protein-tyrosine kinase Mpk-9, Ribosomal S6 kinase 3, pp90RSK3) (Biotin) discontinued

Sign In for Pricing
View Details
EpiQuik Global Acetyl Histone H4K5 Quantification Kit (Fluorometric)
P-4023 96 Assays

EpiQuik Global Acetyl Histone H4K5 Quantification Kit (Fluorometric)

Sign In for Pricing
View Details
LNX1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV711987 1.0 µg DNA

LNX1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Probable histidine ammonia-lyase (hal), partial
MBS1324815 Inquire

Recombinant Dictyostelium discoideum Probable histidine ammonia-lyase (hal), partial

Sign In for Pricing
View Details
Brivudine Impurity 42
RM-B182142-01 10 mg

Brivudine Impurity 42

Sign In for Pricing
View Details
Brivudine Impurity 42
RM-B182142-02 25 mg

Brivudine Impurity 42

Sign In for Pricing
View Details