Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK2 Peptide - middle region

AK2 Peptide - middle region

Product Specifications

Product Name Alternative

ADK2

UniProt

P54819

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186128.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-African clawed frog T cell receptor beta C Antibody, APC Conjugate
DZ41069-APC 200 µL/Vial

Anti-African clawed frog T cell receptor beta C Antibody, APC Conjugate

Sign In for Pricing
View Details
Mouse Thymic stromal lymphopoietin ELISA Kit
MBS2880627-01 48 Well

Mouse Thymic stromal lymphopoietin ELISA Kit

Sign In for Pricing
View Details
Mouse Thymic stromal lymphopoietin ELISA Kit
MBS2880627-02 96 Well

Mouse Thymic stromal lymphopoietin ELISA Kit

Sign In for Pricing
View Details
Mouse Thymic stromal lymphopoietin ELISA Kit
MBS2880627-03 5x 96 Well

Mouse Thymic stromal lymphopoietin ELISA Kit

Sign In for Pricing
View Details
Mouse Thymic stromal lymphopoietin ELISA Kit
MBS2880627-04 10x 96 Well

Mouse Thymic stromal lymphopoietin ELISA Kit

Sign In for Pricing
View Details
MNX1 Antibody, mAb, Rabbit
A03874-50 50 µL

MNX1 Antibody, mAb, Rabbit

Sign In for Pricing
View Details