Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AK2 Peptide - middle region

AK2 Peptide - middle region

Product Specifications

Product Name Alternative

ADK2

UniProt

P54819

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001186128.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Caspase 8 ELISA Kit
MBS061456-01 48 Well

Hamster Caspase 8 ELISA Kit

Sign In for Pricing
View Details
Hamster Caspase 8 ELISA Kit
MBS061456-02 96 Well

Hamster Caspase 8 ELISA Kit

Sign In for Pricing
View Details
Hamster Caspase 8 ELISA Kit
MBS061456-03 5x 96 Well

Hamster Caspase 8 ELISA Kit

Sign In for Pricing
View Details
Hamster Caspase 8 ELISA Kit
MBS061456-04 10x 96 Well

Hamster Caspase 8 ELISA Kit

Sign In for Pricing
View Details
Olfr665 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4305008 1.0 µg DNA

Olfr665 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
BROX Antibody, FITC conjugated
A57816-100UG 100 µg

BROX Antibody, FITC conjugated

Sign In for Pricing
View Details