Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP2 Peptide - middle region

DUSP2 Peptide - middle region

Product Specifications

Product Name Alternative

PAC1, PAC-1

UniProt

Q05923

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_004409.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QGCCPDLCSEAPAPALPPTGDKTSRSDSRAPVYDQGGPVEILPYLFLGSC

More Discoveries

Explore Other Products

Browse additional items from our catalog

RhoC Rabbit pAb
A21798-01 20 µL

RhoC Rabbit pAb

Sign In for Pricing
View Details
RhoC Rabbit pAb
A21798-02 100 μL

RhoC Rabbit pAb

Sign In for Pricing
View Details
RhoC Rabbit pAb
A21798-03 500 μL

RhoC Rabbit pAb

Sign In for Pricing
View Details
RhoC Rabbit pAb
A21798-04 1000 μL

RhoC Rabbit pAb

Sign In for Pricing
View Details
Pigeon Follistatin ELISA Kit
MBS098595 Inquire

Pigeon Follistatin ELISA Kit

Sign In for Pricing
View Details
OSR2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
35771066 1.0 µg DNA

OSR2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details