Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAE1 Peptide - middle region

SAE1 Peptide - middle region

Product Specifications

Product Name Alternative

AOS1, SUA1, UBLE1A, HSPC140

UniProt

Q9UBE0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001139185.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Non-Specific Lipid-transfer Protein, Recombinant, Malus domestica, aa25-115, His-SUMO-Tag (MALD3)
372979-01 20 µg

Non-Specific Lipid-transfer Protein, Recombinant, Malus domestica, aa25-115, His-SUMO-Tag (MALD3)

Sign In for Pricing
View Details
Non-Specific Lipid-transfer Protein, Recombinant, Malus domestica, aa25-115, His-SUMO-Tag (MALD3)
372979-02 100 µg

Non-Specific Lipid-transfer Protein, Recombinant, Malus domestica, aa25-115, His-SUMO-Tag (MALD3)

Sign In for Pricing
View Details
Sheep CMRF35-like molecule 8 (CD300A) ELISA Kit
MBS7202735-01 48 Well

Sheep CMRF35-like molecule 8 (CD300A) ELISA Kit

Sign In for Pricing
View Details
Sheep CMRF35-like molecule 8 (CD300A) ELISA Kit
MBS7202735-02 96 Well

Sheep CMRF35-like molecule 8 (CD300A) ELISA Kit

Sign In for Pricing
View Details
Sheep CMRF35-like molecule 8 (CD300A) ELISA Kit
MBS7202735-03 5x 96 Well

Sheep CMRF35-like molecule 8 (CD300A) ELISA Kit

Sign In for Pricing
View Details
Sheep CMRF35-like molecule 8 (CD300A) ELISA Kit
MBS7202735-04 10x 96 Well

Sheep CMRF35-like molecule 8 (CD300A) ELISA Kit

Sign In for Pricing
View Details