Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB21 Peptide - middle region

RAB21 Peptide - middle region

Product Specifications

UniProt

Q9UL25

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055814.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-3144-5p miRNA Antagomir
orb1915381-01 10 nmol

Hsa-miR-3144-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-3144-5p miRNA Antagomir
orb1915381-02 20 nmol

Hsa-miR-3144-5p miRNA Antagomir

Sign In for Pricing
View Details
FOXP2 Protein Vector (Mouse) (pPB-C-His)
PV180178 500 ng

FOXP2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
PACAP-38 (16-38) (Human, Chicken, Mouse, Ovine, Porcine, Rat)
MBS8246870-01 1 mg

PACAP-38 (16-38) (Human, Chicken, Mouse, Ovine, Porcine, Rat)

Sign In for Pricing
View Details
PACAP-38 (16-38) (Human, Chicken, Mouse, Ovine, Porcine, Rat)
MBS8246870-02 5 mg

PACAP-38 (16-38) (Human, Chicken, Mouse, Ovine, Porcine, Rat)

Sign In for Pricing
View Details
PACAP-38 (16-38) (Human, Chicken, Mouse, Ovine, Porcine, Rat)
MBS8246870-03 10 mg

PACAP-38 (16-38) (Human, Chicken, Mouse, Ovine, Porcine, Rat)

Sign In for Pricing
View Details