Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB21 Peptide - middle region

RAB21 Peptide - middle region

Product Specifications

UniProt

Q9UL25

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_055814.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (GFR1195), CF740 conjugate, 0.1mg/mL
BNC741195-500 1x 500 µL

EGFR (GFR1195), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human COL6A3/Collagen-VI Protein
PKSH030495 100 µg

Recombinant Human COL6A3/Collagen-VI Protein

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-500 1x 500 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details