Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMYD2 Peptide - middle region

SMYD2 Peptide - middle region

Product Specifications

Product Name Alternative

KMT3C, HSKM-B, ZMYND14

UniProt

Q9NRG4

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_064582.2

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKD

More Discoveries

Explore Other Products

Browse additional items from our catalog

2700049A03Rik Protein Lysate (Mouse) with C-HA Tag
10482034 100 µg

2700049A03Rik Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Phospho-Ataxin 1 (Ser775) Polyclonal Antibody, HRP Conjugated
bs-3008R-HRP 100 µL

Phospho-Ataxin 1 (Ser775) Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Rab33b Mouse shRNA Plasmid (Locus ID 19338)
TL501833 1 Kit

Rab33b Mouse shRNA Plasmid (Locus ID 19338)

Sign In for Pricing
View Details
Anti-Stefin B/CSTB Antibody Picoband® (Dylight488 Conjugate)
PA2106-Dylight488 100 µg

Anti-Stefin B/CSTB Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Ferrochelatase (hemH)
MBS1218121-01 0.02 mg (E-Coli)

Recombinant Pseudomonas putida Ferrochelatase (hemH)

Sign In for Pricing
View Details
Recombinant Pseudomonas putida Ferrochelatase (hemH)
MBS1218121-02 0.02 mg (Yeast)

Recombinant Pseudomonas putida Ferrochelatase (hemH)

Sign In for Pricing
View Details