Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGDH Peptide - C-terminal region

UGDH Peptide - C-terminal region

Product Specifications

Product Name Alternative

GDH, UGD, UDPGDH, UDP-GlcDH

UniProt

O60701

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001171629.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDGLHNELQTIGFQIETIGKKVSSKRIPYAPSGEIPKFSLQDPPNKKPKV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Neuromedin B (NMB) Human qPCR Primer Pair (NM_205858)
HP230805 200 Reactions

Neuromedin B (NMB) Human qPCR Primer Pair (NM_205858)

Sign In for Pricing
View Details
Human ALK tyrosine kinase receptor (ALK) ELISA Kit
abx515273 96 Well

Human ALK tyrosine kinase receptor (ALK) ELISA Kit

Sign In for Pricing
View Details
FAM107A Rabbit Polyclonal Antibody
TA376088 100 µL

FAM107A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCNA1 Antibody
MBS7104789-01 0.05 mg

CCNA1 Antibody

Sign In for Pricing
View Details
CCNA1 Antibody
MBS7104789-02 0.1 mg

CCNA1 Antibody

Sign In for Pricing
View Details
CCNA1 Antibody
MBS7104789-03 5x 0.1 mg

CCNA1 Antibody

Sign In for Pricing
View Details