Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1A1 Peptide - middle region

AKR1A1 Peptide - middle region

Product Specifications

Product Name Alternative

ALR, ARM, DD3, ALDR1, HEL-S-6

UniProt

P14550

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_001189342.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLGSSDRAWRDPDEPVLLEEPVVLALAEKYGRSPAQILLRWQVQRKVICI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PARP7 (TIPARP) (NM_001184718) Human Tagged Lenti ORF Clone
RC230399L4 10 µg

PARP7 (TIPARP) (NM_001184718) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Gapt 3'UTR Luciferase Stable Cell Line
TU106909 1.0 mL

Gapt 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ORC4L Antibody (C-term)
GWB-742BA4 0.1 mg

ORC4L Antibody (C-term)

Sign In for Pricing
View Details
ICOSLG AAV siRNA Pooled Vector
24156161 1.0 µg

ICOSLG AAV siRNA Pooled Vector

Sign In for Pricing
View Details
TRAP220 T1457 Rabbit Polyclonal Antibody
E53P06059 100 µL

TRAP220 T1457 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human GALNT3 Protein (His Tag)
PKSH032915-01 10 µg

Recombinant Human GALNT3 Protein (His Tag)

Sign In for Pricing
View Details